ERK1 anticorps (AA 372-406)
-
- Antigène Voir toutes ERK1 (MAPK3) Anticorps
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
-
Épitope
- AA 372-406
-
Reactivité
- Souris, Rat, Lapin, Hamster
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ERK1 est non-conjugé
-
Application
- Western Blotting (WB), Immunoprecipitation (IP), Functional Studies (Func)
- Specificité
- Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.
- Homologie
- Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
- Purification
- Immunoaffinity purified
- Immunogène
-
Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).
Type of Immunogen: Synthetic peptide - KLH conjugated - Isotype
- IgG
- Top Product
- Discover our top product MAPK3 Anticorps primaire
-
-
- Indications d'application
-
Approved: Func, IP, WB (0.1 - 2 μg/mL)
Usage: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 μg/mL detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 μg immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/mL) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit. - Commentaires
-
Target Species of Antibody: Rat
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- 0.2 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 0.1 mM EDTA.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeat freeze-thaw cycles.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
-
- Antigène
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
- Autre désignation
- MAPK3 / ERK1 (MAPK3 Produits)
- Synonymes
- anticorps ERK-1, anticorps ERK1, anticorps ERT2, anticorps HS44KDAP, anticorps HUMKER1A, anticorps P44ERK1, anticorps P44MAPK, anticorps PRKM3, anticorps p44-ERK1, anticorps p44-MAPK, anticorps Erk-1, anticorps Erk1, anticorps Ert2, anticorps Esrk1, anticorps Mnk1, anticorps Mtap2k, anticorps Prkm3, anticorps p44, anticorps p44erk1, anticorps p44mapk, anticorps ERK3, anticorps ERK6, anticorps P38GAMMA, anticorps PRKM12, anticorps SAPK-3, anticorps SAPK3, anticorps fi06b09, anticorps wu:fi06b09, anticorps zERK1, anticorps Tb08.10J17.940, anticorps MAPK1, anticorps MNK1, anticorps AW123708, anticorps Erk6, anticorps P38gamma, anticorps Prkm12, anticorps Sapk3, anticorps ATMAPK3, anticorps ATMPK3, anticorps T6D9.4, anticorps mitogen-activated protein kinase 3, anticorps mitogen-activated protein kinase 3, anticorps mitogen-activated protein kinase 12, anticorps mitogen activated protein kinase 3, anticorps mitogen-activated serine/threonine-protein kinase, anticorps MAPK3, anticorps Mapk3, anticorps MAPK12, anticorps mapk3, anticorps Tc00.1047053509475.10, anticorps Tb927.8.3550, anticorps Mapk12, anticorps CEK1, anticorps MPK3
- Sujet
-
Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase
Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3 - ID gène
- 5595
- UniProt
- P27361
- Pathways
- Signalisation MAPK, Signalisation RTK, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins
-