DcR1 anticorps

N° du produit ABIN2379279

Détail du produit anti-DcR1 anticorps

Antigène: DcR1 (TNFRSF10C) (Tumor Necrosis Factor Receptor Superfamily, Member 10c (TNFRSF10C))

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp DcR1 est non-conjugé

Application: Western Blotting (WB), ELISA, Flow Cytometry (FACS), Immunochromatography (IC)

Séquence: EVPQQTVAPQ QQRHSFKGEE CPAGSHRSEH TC

Réactivité croisée: Humain

Réactivité croisée (Details): Calculated cross reactivity: Hu

Attributs du produit: TRAIL Receptor 3 (TRAIL R3, TNF-Related Apoptosis Inducing Receptor3)

Purification: Purified by immunoaffinity chromatography.

Immunogène: Synthetic peptide (EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC) corresponding to the extracellular domain sequence of human TRAIL-R3.

Isotype: IgG

Information d'application

Indications d'application: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 1 mg/mL BSA, 0.09 % sodium azide before the addition of 40 % glycerol.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: -20°C

Détails sur DcR1

Antigène: DcR1 (TNFRSF10C) (Tumor Necrosis Factor Receptor Superfamily, Member 10c (TNFRSF10C))

Autre désignation: TRAIL Receptor 3 (TNFRSF10C Produits)

Synonymes: anticorps CD263, anticorps DCR1, anticorps DCR1-TNFR, anticorps LIT, anticorps TRAIL-R3, anticorps TRAILR3, anticorps TRID, anticorps TNFRSF10C, anticorps TNF receptor superfamily member 10c, anticorps TNFRSF10C

NCBI Accession: NP_003801

Pathways: Apoptose