BMI1 anticorps (Middle Region)

N° du produit ABIN3030170

Détail du produit anti-BMI1 anticorps

Antigène: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BMI1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: An amino acid sequence from the middle region of human Bmi1 (IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR) was used as the immunogen for this Bmi1 antibody.

Isotype: IgG

Information d'application

Indications d'application: The stated application concentrations are suggested starting amounts. Titration of the Bmi1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Bmi1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur BMI1

Antigène: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Autre désignation: Bmi1 (BMI1 Produits)

Synonymes: anticorps FLVI2/BMI1, anticorps PCGF4, anticorps RNF51, anticorps AW546694, anticorps Bmi-1, anticorps Pcgf4, anticorps bmi1, anticorps pcgf4, anticorps psc1, anticorps wu:fb17g03, anticorps wu:fd18f06, anticorps BMI-1, anticorps pcgf4b, anticorps bmi-1, anticorps bmi1-a, anticorps bmi1-b, anticorps bmi1b, anticorps rnf51, anticorps xbmi-1, anticorps BMI1 proto-oncogene, polycomb ring finger, anticorps BMI1 polycomb ring finger oncogene, anticorps Bmi1 polycomb ring finger oncogene, anticorps bmi1 polycomb ring finger oncogene 1a, anticorps bmi1 polycomb ring finger oncogene 1b, anticorps BMI1 proto-oncogene, polycomb ring finger L homeolog, anticorps BMI1, anticorps LOC100230513, anticorps Bmi1, anticorps bmi1a, anticorps bmi1b, anticorps bmi1.L

Sujet: B lymphoma Mo MLV insertion region 1, also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human gene is assigned to chromosome 10p13. It has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that the protein completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4). BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that the protein transiently colocalized with centromeres during interphase in HeLa cells.

ID gène: 648

Pathways: Cycle Cellulaire, Autophagy