PIM1 anticorps (C-Term)
-
- Antigène Voir toutes PIM1 Anticorps
- PIM1 (Pim-1 Oncogene (PIM1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIM1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogène
- An amino acid sequence from the C-terminus of human PIM1 (EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK) was used as the immunogen for this PIM-1 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product PIM1 Anticorps primaire
-
anti-Pim-1 Oncogene (PIM1) (AA 122-261) antibody
PIM1 Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 1-100) antibodyPIM1 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 1C10 unconjugated
anti-Pim-1 Oncogene (PIM1) antibodyPIM1 Reactivité: Humain WB, IHC Hôte: Lapin Monoclonal unconjugated
anti-Pim-1 Oncogene (PIM1) (Internal Region) antibodyPIM1 Reactivité: Humain, Souris, Rat WB, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 374-404), (C-Term) antibodyPIM1 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB1285-RB1286 unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 1-100) antibodyPIM1 Reactivité: Humain WB, ELISA, IHC (p), IF Hôte: Souris Monoclonal 2C9 unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 1-313) antibodyPIM1 Reactivité: Humain ELISA, IHC (p), IF Hôte: Souris Monoclonal 3F5 unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 129-268) antibodyPIM1 Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 25-86) antibodyPIM1 Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 343-372), (C-Term) antibodyPIM1 Reactivité: Humain, Souris WB Hôte: Lapin Polyclonal RB34666 unconjugated
-
- Indications d'application
- The stated application concentrations are suggested starting amounts. Titration of the PIM-1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the PIM-1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- PIM1 (Pim-1 Oncogene (PIM1))
- Autre désignation
- PIM-1 (PIM1 Produits)
- Synonymes
- anticorps PIM, anticorps Pim-1, anticorps PIM1, anticorps pim, anticorps pim-1, anticorps pim3, anticorps Pim-1 proto-oncogene, serine/threonine kinase, anticorps proviral integration site 1, anticorps Pim-1 proto-oncogene, serine/threonine kinase L homeolog, anticorps PIM1, anticorps Pim1, anticorps pim1, anticorps pim1.L
- Sujet
- Proto-oncogene serine/threonine-protein kinase PIM-1 is an enzyme that in humans is encoded by the PIM1 gene. It is mapped to 6p21.2. Primarily expressed in spleen, thymus, bone marrow, prostate, oral epithelial, hippocampus and fetal liver cells, It has also been found to be highly expressed in cell cultures isolated from human tumors. PIM-1 is mainly involved in cell cycle progression, apoptosis and transcriptional activation, as well as more general signal transduction pathways. It has been found a physiologic role of the PIM-1 oncogene during hematopoietic development and a deregulation of the gene in various leukemias. It also has a role in cardioprotection downstream of AKT activation.
- ID gène
- 5292
- Pathways
- Glycosaminoglycan Metabolic Process
-
