RUNX1 anticorps (Middle Region)

N° du produit ABIN3032499

Détail du produit anti-RUNX1 anticorps

Antigène: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RUNX1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: An amino acid sequence from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN) was used as the immunogen for this RUNX1 antibody (100% homologous in human, mouse and rat).

Isotype: IgG

Information d'application

Indications d'application: The stated application concentrations are suggested starting amounts. Titration of the RUNX1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the RUNX1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur RUNX1

Antigène: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Autre désignation: RUNX1 (AML1) (RUNX1 Produits)

Synonymes: anticorps RUNX1, anticorps runx1, anticorps AI462102, anticorps AML1, anticorps Cbfa2, anticorps Pebp2a2, anticorps Pebpa2b, anticorps AML1-EVI-1, anticorps AMLCR1, anticorps CBFA2, anticorps EVI-1, anticorps PEBP2aB, anticorps runxa, anticorps Runx-1, anticorps XAML, anticorps Xaml1, anticorps aml, anticorps aml-1, anticorps aml1, anticorps aml1-evi-1, anticorps amlcr1, anticorps cbfa2, anticorps evi-1, anticorps pebp2ab, anticorps Aml1, anticorps uncharacterized LOC473981, anticorps runt-related transcription factor, anticorps runt related transcription factor 1, anticorps runt-related transcription factor 1, anticorps runt related transcription factor 1 L homeolog, anticorps LOC473981, anticorps runt, anticorps Runx1, anticorps RUNX1, anticorps runx1, anticorps runx1.L

Sujet: Runt-related transcription factor 1, also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called Core binding factor alpha (CBFa). RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX proteins form a heterodimeric complex with CBFb which confers increased DNA binding and stability to the complex. Chromosomal translocations involving the gene are associated with several types of leukemia including M2 AML. Mutations are implicated in cases of breast cancer.

ID gène: 861