WNT7A anticorps (C-Term)
-
- Antigène Voir toutes WNT7A Anticorps
- WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))
-
Épitope
- AA 226-256, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WNT7A est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Protein Wnt-7a(WNT7A) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- YVLKDKYNEA VHVEPVRASR NKRPTFLKIK K
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Protein Wnt-7a(WNT7A) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: wingless-type MMTV integration site family, member 7A
Protein Name: Protein Wnt-7a - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product WNT7A Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))
- Autre désignation
- WNT7A (WNT7A Produits)
- Synonymes
- anticorps wnt7a, anticorps AI849442, anticorps Wnt-7a, anticorps px, anticorps tw, anticorps Xwnt-7a, anticorps wnt-7a, anticorps wnt7a-A, anticorps Wnt family member 7A, anticorps wingless-type MMTV integration site family, member 7Aa, anticorps wingless-type MMTV integration site family, member 7A, anticorps wingless-type MMTV integration site family member 7A S homeolog, anticorps WNT7A, anticorps wnt7aa, anticorps Wnt7a, anticorps wnt7a.S
- Sujet
-
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas - Rothschild / Schinzel phocomelia syndromes.
Synonyms: Protein Wnt-7a antibody|Protein Wnt-7a precursor antibody|Proto oncogene Wnt7a protein antibody|proto-oncogene wnt7a protein antibody| wingless-type MMTV integration site family, member 7A antibody|WNT7A antibody|WNT7A_HUMAN antibody - ID gène
- 7476
- UniProt
- O00755
- Pathways
- Signalisation WNT, Stem Cell Maintenance, Asymmetric Protein Localization
-