PAR1 anticorps (N-Term)

N° du produit ABIN3042380

Détail du produit anti-PAR1 anticorps

Antigène: PAR1 (F2R) (Coagulation Factor II (thrombin) Receptor (F2R))

Épitope: AA 46-82, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAR1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 1(F2R) detection. Tested with WB, IHC-P in Human.

Séquence: RNPNDKYEPF WEDEEKNESG LTEYRLVSIN KSSPLQK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 1(F2R) detection. Tested with WB, IHC-P in Human.
Gene Name: coagulation factor II (thrombin) receptor
Protein Name: Proteinase-activated receptor 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor (46-82aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PAR1

Antigène: PAR1 (F2R) (Coagulation Factor II (thrombin) Receptor (F2R))

Autre désignation: F2R (F2R Produits)

Synonymes: anticorps CF2R, anticorps HTR, anticorps PAR-1, anticorps PAR1, anticorps TR, anticorps Par1, anticorps TRGPC, anticorps AI482343, anticorps Cf2r, anticorps ThrR, anticorps Par-1, anticorps f2r-a, anticorps par1, anticorps coagulation factor II thrombin receptor, anticorps coagulation factor II (thrombin) receptor, anticorps coagulation factor 2 (thrombin) receptor L homeolog, anticorps F2R, anticorps F2r, anticorps f2r.L

Sujet: Proteinase-activated receptor 1 (PAR1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model.

Synonyms: CF2R antibody|Coagulation factor II (thrombin) receptor antibody|Coagulation factor II receptor antibody|F2R antibody|HTR antibody|PAR 1 antibody|PAR-1 antibody|PAR1 antibody|PAR1_HUMAN antibody|Protease activated receptor 1 antibody|Proteinase activated receptor 1 antibody|Proteinase-activated receptor 1 antibody|Thrombin receptor antibody|TR antibody

ID gène: 2149

UniProt: P25116

Pathways: Nuclear Receptor Transcription Pathway, Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus