GJA3 anticorps (N-Term)

N° du produit ABIN3042423

Détail du produit anti-GJA3 anticorps

Antigène: GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))

Épitope: AA 89-118, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJA3 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein(GJA3) detection. Tested with WB in Human,Mouse,Rat.

Séquence: TLIYLGHVLH IVRMEEKKKE REEEEQLKRE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein(GJA3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: gap junction protein, alpha 3, 46 kDa
Protein Name: Gap junction alpha-3 protein

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur GJA3

Antigène: GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))

Autre désignation: GJA3 (GJA3 Produits)

Synonymes: anticorps cx46, anticorps MGC53082, anticorps czp3, anticorps Cx44, anticorps cx48.5, anticorps Cnx46, anticorps Cx43, anticorps Cx46, anticorps Gja-3, anticorps CTRCT14, anticorps CX46, anticorps CZP3, anticorps MGC69466 protein L homeolog, anticorps gap junction protein alpha 3, anticorps gap junction protein, alpha 3, anticorps MGC69466.L, anticorps gja3, anticorps GJA3, anticorps Gja3

Sujet: Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).

Synonyms: CAE3 antibody|Connexin 46 antibody|Connexin-46 antibody|Connexin46 antibody|Cx46 antibody|CXA3_HUMAN antibody|CZP3 antibody|Gap junction alpha 3 protein antibody|Gap junction alpha-3 protein antibody|Gap junction protein, alpha 3, 46kD (connexin 46) antibody|Gap junction protein, alpha 3, 46 kDa (connexin 46) antibody|Gap junction protein, alpha 3, 46 kDa antibody|Gja3 antibody

ID gène: 2700

UniProt: Q9Y6H8