PLA2G4A anticorps (C-Term)

N° du produit ABIN3042503

Détail du produit anti-PLA2G4A anticorps

Antigène: PLA2G4A (Phospholipase A2, Group IVA (Cytosolic, Calcium-Dependent) (PLA2G4A))

Épitope: AA 682-721, C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLA2G4A est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Cytosolic phospholipase A2(PLA2G4A) detection. Tested with WB in Human,Mouse.

Séquence: NFQYPNQAFK RLHDLMHFNT LNNIDVIKEA MVESIEYRRQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Cytosolic phospholipase A2(PLA2G4A) detection. Tested with WB in Human,Mouse.
Gene Name: phospholipase A2, group IVA (cytosolic, calcium-dependent)
Protein Name: Cytosolic phospholipase A2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PLA2G4A (682-721aa NFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQ), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PLA2G4A

Antigène: PLA2G4A (Phospholipase A2, Group IVA (Cytosolic, Calcium-Dependent) (PLA2G4A))

Autre désignation: PLA2G4A (PLA2G4A Produits)

Synonymes: anticorps PLA2G4, anticorps cPLA2-alpha, anticorps Pla2c, anticorps Pla2g4, anticorps cPLA2, anticorps pla2g4, anticorps CPLA2, anticorps PLA2G4A, anticorps PLA2, anticorps PLA2G1B, anticorps cPLA2alpha, anticorps pla2g4a, anticorps si:dkey-97o5.1, anticorps phospholipase A2 group IVA, anticorps phospholipase A2 group IVA L homeolog, anticorps phospholipase A2, group IVA (cytosolic, calcium-dependent), anticorps phospholipase A2, group IVAb (cytosolic, calcium-dependent), anticorps PLA2G4A, anticorps Pla2g4a, anticorps pla2g4a.L, anticorps pla2g4ab

Sujet: PLA2G4A (Phospholipase A2, Group IVA), is an enzyme that in humans is encoded by the PLA2G4A gene. Tay et al. (1995) mapped the PLA2G4A gene to rat chromosome 13 by PCR-based intercross genotyping and to human 1q25 by fluorescence in situ hybridization. By site-directed mutagenesis and biochemical analysis of the recombinant protein, Sharp et al. (1994) determined that ser228 participates in the catalytic mechanism of cPLA2 and that both the phospholipase A2 and the lysophospholipase activities are catalyzed by the same active site residue(s). PLA2G4A, the cytosolic phospholipase A2, appears to subserve transmembrane signaling responses to extracellular ligands (Skorecki, 1995).

Synonyms: Calcium dependent phospholipid binding protein antibody|CPLA 2 antibody|cPLA2 alpha antibody|cPLA2 antibody|Cytosolic phospholipase A2 antibody|Cytosolic phospholipase A2 group IVA antibody|Lysophospholipase antibody|MGC126350 antibody|PA24A_HUMAN antibody| Phosphatidylcholine 2 acylhydrolase antibody|Phosphatidylcholine 2-acylhydrolase antibody| Phospholipase A2 group 4 A antibody| Phospholipase A2 group IVA (cytosolic calcium dependent) antibody|Phospholipase A2 group IVA antibody|PhospholipaseA2 antibody|PLA2G4 antibody|pla2g4a antibody

ID gène: 5321

UniProt: P47712

Pathways: Inositol Metabolic Process, G-protein mediated Events, VEGF Signaling