IGFBPI anticorps (C-Term)

N° du produit ABIN3042732

Détail du produit anti-IGFBPI anticorps

Antigène: IGFBPI (Insulin-Like Growth Factor Binding Protein 1 (IGFBPI))

Épitope: AA 177-207, C-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGFBPI est non-conjugé

Application: Western Blotting (WB), ELISA

Fonction: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 1(IGFBP1) detection. Tested with WB, ELISA in Mouse,Rat.

Séquence: REIADLKKWK EPCQRELYKV LERLAAAQQK A

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 1(IGFBP1) detection. Tested with WB, ELISA in Mouse,Rat.
Gene Name: insulin-like growth factor binding protein 1
Protein Name: Insulin-like growth factor-binding protein 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP-1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse

Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur IGFBPI

Antigène: IGFBPI (Insulin-Like Growth Factor Binding Protein 1 (IGFBPI))

Autre désignation: IGFBP1 (IGFBPI Produits)

Synonymes: anticorps cb656, anticorps igfbp1, anticorps IGFBP-1, anticorps MGC68538, anticorps afbp, anticorps ibp1, anticorps pp12, anticorps igf-bp25, anticorps higfbp-1, anticorps IGFBP1, anticorps LOC100223208, anticorps LOC100305121, anticorps AFBP, anticorps IBP1, anticorps IGF-BP25, anticorps PP12, anticorps hIGFBP-1, anticorps IGFBA, anticorps insulin like growth factor binding protein 1, anticorps insulin-like growth factor binding protein 1a, anticorps insulin like growth factor binding protein 1 S homeolog, anticorps insulin like growth factor binding protein 1 L homeolog, anticorps insulin-like growth factor binding protein 1, anticorps IGFBP1, anticorps igfbp1a, anticorps igfbp1.S, anticorps igfbp1.L, anticorps igfbp1, anticorps LOC100305121, anticorps Igfbp1

Sujet: IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Synonyms: AFBP antibody|Alpha pregnancy associated endometrial globulin antibody|Amniotic fluid binding protein antibody|Binding protein 25 antibody|Binding protein 26 antibody|Binding protein 28 antibody|Growth hormone independent binding protein antibody|hIGFBP 1 antibody|hIGFBP1 antibody|IBP 1 antibody|IBP-1 antibody|IBP1 antibody|IBP1_HUMAN antibody|IGF binding protein 1 antibody|IGF BP25 antibody|IGF-binding protein 1 antibody|IGFBP 1 antibody|IGFBP-1 antibody|IGFBP1 antibody|Insulin Like Growth Factor Binding Protein 1 antibody|Insulin-like growth factor-binding protein 1 antibody|Placental protein 12 antibody|PP 12 antibody|PP12 antibody

ID gène: 16006

UniProt: P47876

Pathways: Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Growth Factor Binding