RAB11A anticorps (C-Term)
-
- Antigène Voir toutes RAB11A Anticorps
- RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))
-
Épitope
- AA 171-211, C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAB11A est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Ras-related protein Rab-11A(RAB11A) detection. Tested with WB in Human.
- Séquence
- EIYRIVSQKQ MSDRRENDMS PSNNVVPIHV PPTTENKPKV Q
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Ras-related protein Rab-11A(RAB11A) detection. Tested with WB in Human.
Gene Name: RAB11A, member RAS oncogene family
Protein Name: Ras-related protein Rab-11A - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product RAB11A Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))
- Autre désignation
- RAB11A (RAB11A Produits)
- Synonymes
- anticorps rab11, anticorps RAB11A, anticorps wu:fi15h09, anticorps zgc:103679, anticorps yl8, anticorps Rab11a, anticorps rab11A, anticorps DDBDRAFT_0190819, anticorps DDBDRAFT_0191190, anticorps DDB_0190819, anticorps DDB_0191190, anticorps YL8, anticorps RAB11, anticorps RAB11A, member RAS oncogene family S homeolog, anticorps RAB11A, member RAS oncogene family, anticorps RAB11a, member RAS oncogene family, anticorps Rab11 GTPase, anticorps rab11A protein, anticorps Rab11a, GTPase, anticorps Rab GTPase, anticorps rab11A, RAB family GTPase, anticorps rab11a.S, anticorps RAB11A, anticorps rab11a, anticorps Rab11a, anticorps rab11A
- Sujet
-
Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.
Synonyms: MGC1490 antibody|Rab 11 antibody|Rab 11A antibody|RAB 11A member oncogene family antibody|RAB 11A, member oncogene family antibody| Rab-11 antibody|RAB11 A antibody|RAB11 antibody|RAB11A antibody|RAB11A member RAS oncogene family antibody|Ras related protein Rab 11A antibody|Ras related protein Rab11A antibody|Ras-related protein Rab-11A antibody|YL 8 antibody|YL8 antibody - ID gène
- 8766
- UniProt
- P62491
- Pathways
- Regulation of Cell Size, Thromboxane A2 Receptor Signaling, Regulation of long-term Neuronal Synaptic Plasticity
-