HRAS anticorps (C-Term)

N° du produit ABIN3043845

Détail du produit anti-HRAS anticorps

Antigène: HRAS (HRas proto-oncogene, GTPase (HRAS))

Épitope: AA 101-137, C-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HRAS est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.

Séquence: KRVKDSDDVP MVLVGNKCDL AARTVESRQA QDLAR

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Harvey rat sarcoma viral oncogene homolog
Protein Name: GTPase Hras

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HRAS

Antigène: HRAS (HRas proto-oncogene, GTPase (HRAS))

Autre désignation: HRAS (HRAS Produits)

Synonymes: anticorps C-BAS/HAS, anticorps C-H-RAS, anticorps C-HA-RAS1, anticorps CTLO, anticorps H-RASIDX, anticorps HAMSV, anticorps HRAS1, anticorps K-RAS, anticorps N-RAS, anticorps RASH1, anticorps hras, anticorps zgc:110250, anticorps HRAS, anticorps H-RAS, anticorps c-H-ras, anticorps H-Ras, anticorps K-Ras, anticorps hras1, anticorps rash1, anticorps ras, anticorps N-Ras, anticorps c-bas/has, anticorps H-ras, anticorps Ha-ras, anticorps Harvey-ras, anticorps Hras-1, anticorps Kras2, anticorps c-Ha-ras, anticorps c-rasHa, anticorps hrasl, anticorps zgc:110734, anticorps HRas proto-oncogene, GTPase, anticorps v-Ha-ras Harvey rat sarcoma viral oncogene homolog a, anticorps neuroblastoma RAS viral (v-ras) oncogene homolog pseudogene, anticorps Harvey rat sarcoma viral oncogene homolog L homeolog, anticorps Harvey rat sarcoma viral oncogene homolog, anticorps Harvey rat sarcoma virus oncogene, anticorps NRAS proto-oncogene, GTPase, anticorps -Ha-ras Harvey rat sarcoma viral oncogene homolog b, anticorps HRAS, anticorps hrasa, anticorps LOC733587, anticorps Hras, anticorps hras.L, anticorps hras, anticorps NRAS, anticorps hrasb

Sujet: GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.

Synonyms: C BAS/HAS antibody|c H ras antibody|C HA RAS1 antibody|c has/bas p21 protein antibody|c ras Ki 2 activated oncogene antibody|c-H-ras antibody|CTLO antibody|GTP and GDP binding peptide B antibody|GTPase HRas, N-terminally processed antibody|H Ras 1 antibody|H RASIDX antibody|H-Ras-1 antibody|Ha Ras antibody|Ha Ras1 proto oncoprotein antibody|Ha-Ras antibody|HAMSV antibody|Harvey rat sarcoma viral oncogene homolog antibody|Harvey rat sarcoma viral oncoprotein antibody|HRAS antibody|HRAS1 antibody|K ras antibody|N ras antibody|p19 H RasIDX protein antibody|p21ras antibody|Ras family small GTP binding protein H Ras antibody|RASH_HUMAN antibody|RASH1 antibody| Transformation gene oncogene HAMSV antibody|Transforming protein p21 antibody|v Ha ras Harvey rat sarcoma viral oncogene homolog antibody|VH Ras antibody|vHa RAS antibody

ID gène: 3265

UniProt: P01112

Pathways: Signalisation p53, Signalisation MAPK, Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hepatitis C, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Regulation of long-term Neuronal Synaptic Plasticity, VEGF Signaling, BCR Signaling