SLC12A1 anticorps (N-Term)

N° du produit ABIN3043925

Détail du produit anti-SLC12A1 anticorps

Antigène: SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))

Épitope: AA 52-83, N-Term

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC12A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Solute carrier family 12 member 1(SLC12A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DEAQKRLRIS FRPGNQECYD NFLQSGETAK TD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Solute carrier family 12 member 1(SLC12A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: solute carrier family 12 (sodium/potassium/chloride transporters), member 1
Protein Name: Solute carrier family 12 member 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse , The detection limit for SLC12A1 is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SLC12A1

Antigène: SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))

Autre désignation: SLC12A1 (SLC12A1 Produits)

Synonymes: anticorps slc12a1, anticorps SLC12A1, anticorps DKFZp469A2020, anticorps BSC1, anticorps NKCC2, anticorps Nkcc2, anticorps AI788571, anticorps D630042G03Rik, anticorps mBSC1, anticorps urehr3, anticorps si:ch211-220f12.1, anticorps solute carrier family 12 member 1, anticorps solute carrier family 12, member 1, anticorps si:ch211-220f12.1, anticorps SLC12A1, anticorps Slc12a1

Sujet: Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume.

Synonyms: BSC1 antibody|Bumetanide sensitive sodium 3 antibody|Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2 antibody|Kidney specific Na K Cl symporter antibody|Kidney-specific Na-K-Cl symporter antibody|MGC48843 antibody|Na K 2Cl cotransporter antibody|NKCC2 antibody|potassiumchloride cotransporter 2 antibody|S12A1_HUMAN antibody|Slc12a1 antibody|sodium potassium chloride cotransporter 2 antibody|solute carrier family 12 (sodium/potassium/chloride transporters) antibody|Solute carrier family 12 member 1 antibody

ID gène: 6557

UniProt: Q13621