RENT1/UPF1 anticorps (Middle Region)

N° du produit ABIN3043955

Détail du produit anti-RENT1/UPF1 anticorps

Antigène: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Épitope: AA 578-614, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RENT1/UPF1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 1(UPF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: NMDSMPELQK LQQLKDETGE LSSADEKRYR ALKRT

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 1(UPF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: UPF1 regulator of nonsense transcripts homolog (yeast)
Protein Name: Regulator of nonsense transcripts 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur RENT1/UPF1

Antigène: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Autre désignation: UPF1 (UPF1 Produits)

Synonymes: anticorps HUPF1, anticorps NORF1, anticorps RENT1, anticorps pNORF1, anticorps smg-2, anticorps B430202H16Rik, anticorps PNORF-1, anticorps Rent1, anticorps Upflp, anticorps rent1, anticorps wu:fi40f07, anticorps wu:fj48a01, anticorps zgc:55472, anticorps Tb05.3C6.50, anticorps AO090012000584, anticorps hupf1, anticorps norf1, anticorps pnorf1, anticorps upf1, anticorps UPF1, RNA helicase and ATPase, anticorps UPF1 regulator of nonsense transcripts homolog (yeast), anticorps upf1 regulator of nonsense transcripts homolog (yeast), anticorps regulator of nonsense transcripts 1, anticorps Regulator of nonsense transcripts 1, anticorps UPF1 regulator of nonsense transcripts homolog S homeolog, anticorps UPF1, anticorps Upf1, anticorps upf1, anticorps Tc00.1047053511317.30, anticorps Tb927.5.2140, anticorps TVAG_453890, anticorps TVAG_237840, anticorps AOR_1_1018194, anticorps HPB8_739, anticorps smg-2, anticorps upf1.S

Sujet: Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.

Synonyms: ATP dependent helicase RENT1 antibody|ATP-dependent helicase RENT1 antibody|Delta helicase antibody|FLJ43809 antibody|FLJ46894 antibody|HUPF 1 antibody|hUpf1 antibody|KIAA0221 antibody|Nonsense mRNA reducing factor 1 antibody|NORF 1 antibody|NORF1 antibody| pNORF 1 antibody|pNORF1 antibody|Regulator of nonsense transcripts 1 antibody|RENT 1 antibody|RENT1 antibody|RENT1_HUMAN antibody|Smg 2 antibody|Smg 2 homolog nonsense mediated mRNA decay factor antibody|UP Frameshift 1 antibody|Up frameshift mutation 1 homolog (S. cerevisiae) antibody|Up frameshift mutation 1 homolog antibody|Up frameshift suppressor 1 homolog antibody|Up-frameshift suppressor 1 homolog antibody|UPF 1 antibody|UPF 1 regulator of nonsense transcripts homolog antibody|upf1 antibody|UPF1 regulator of nonsense transcripts homolog antibody|Yeast Upf1p homolog antibody

ID gène: 5976

UniProt: Q92900

Pathways: SARS-CoV-2 Protein Interactome