STAU1/Staufen anticorps (C-Term)

N° du produit ABIN3044550

Détail du produit anti-STAU1/Staufen anticorps

Antigène: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Épitope: AA 532-568, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STAU1/Staufen est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Double-stranded RNA-binding protein Staufen homolog 1(STAU1) detection. Tested with WB in Human.

Séquence: HGIGKDVESC HDMAALNILK LLSELDQQST EMPRTGN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Double-stranded RNA-binding protein Staufen homolog 1(STAU1) detection. Tested with WB in Human.
Gene Name: staufen double-stranded RNA binding protein 1
Protein Name: Double-stranded RNA-binding protein Staufen homolog 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Staufen (532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur STAU1/Staufen

Antigène: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Autre désignation: STAU1 (STAU1 Produits)

Synonymes: anticorps STAU1, anticorps DKFZp459A0124, anticorps CG5753, anticorps Dmel\\CG5753, anticorps Dmstau, anticorps STAU, anticorps Stau, anticorps Stauf, anticorps dStau, anticorps stau, anticorps XStau, anticorps XStau1, anticorps Staufen, anticorps Staufen1, anticorps MGC145034, anticorps 5830401L18Rik, anticorps AW549911, anticorps C85792, anticorps fi67e05, anticorps wu:fi67e05, anticorps zgc:77271, anticorps staufen double-stranded RNA binding protein 1, anticorps staufen, anticorps RNA binding protein homolog, anticorps staufen (RNA binding protein) homolog 1 (Drosophila), anticorps staufen double-stranded RNA binding protein 1 L homeolog, anticorps STAU1, anticorps stau, anticorps stau1, anticorps STAUFEN, anticorps Stau1, anticorps stau1.L

Sujet: Double-stranded RNA-binding protein Staufen homolog 1 is a protein that in humans is encoded by the STAU1 gene. Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR.

Synonyms: Double stranded RNA binding protein Staufen homolog 1 antibody|Double stranded RNA binding protein Staufen homolog antibody|Double-stranded RNA-binding protein Staufen homolog 1 antibody|FLJ25010 antibody|MGC124588 antibody|STAU antibody|STAU1 antibody|STAU1_HUMAN antibody|staufen antibody|Staufen RNA binding protein (Drosophila) antibody|Staufen RNA binding protein homolog 1 antibody|Staufen, RNA binding protein, homolog 1 (Drosophila) antibody

ID gène: 6780

UniProt: O95793

Pathways: Asymmetric Protein Localization