ERK1 anticorps (AA 336-367)

N° du produit ABIN351563

Détail du produit anti-ERK1 anticorps

Antigène: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Épitope: AA 336-367

Reactivité: Souris, Rat, Lapin, Hamster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERK1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)

Specificité: This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.

Homologie: Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).

Purification: Protein A purified

Immunogène: A 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

Type of Immunogen: Synthetic peptide - KLH conjugated

Information d'application

Indications d'application: Approved: IHC (10 μg/mL), IP (12.5 μg/mL), WB

Usage: Western Blot (Colorimetric): 1 μg/mL 1 μg/mL. Western Blot (ECL). Immunoprecipitation: 12.5 μg/mL. Immunohistochemistry: 10 μg/mL. Positive control: Mouse Brain Tissue Extract.

Commentaires:

Target Species of Antibody: Rat

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: Liquid

Conseil sur la manipulation: Avoid repeat freeze-thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Détails sur ERK1

Antigène: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Autre désignation: MAPK3 / ERK1 (MAPK3 Produits)

Synonymes: anticorps ERK-1, anticorps ERK1, anticorps ERT2, anticorps HS44KDAP, anticorps HUMKER1A, anticorps P44ERK1, anticorps P44MAPK, anticorps PRKM3, anticorps p44-ERK1, anticorps p44-MAPK, anticorps Erk-1, anticorps Erk1, anticorps Ert2, anticorps Esrk1, anticorps Mnk1, anticorps Mtap2k, anticorps Prkm3, anticorps p44, anticorps p44erk1, anticorps p44mapk, anticorps ERK3, anticorps ERK6, anticorps P38GAMMA, anticorps PRKM12, anticorps SAPK-3, anticorps SAPK3, anticorps fi06b09, anticorps wu:fi06b09, anticorps zERK1, anticorps Tb08.10J17.940, anticorps MAPK1, anticorps MNK1, anticorps AW123708, anticorps Erk6, anticorps P38gamma, anticorps Prkm12, anticorps Sapk3, anticorps ATMAPK3, anticorps ATMPK3, anticorps T6D9.4, anticorps mitogen-activated protein kinase 3, anticorps mitogen-activated protein kinase 3, anticorps mitogen-activated protein kinase 12, anticorps mitogen activated protein kinase 3, anticorps mitogen-activated serine/threonine-protein kinase, anticorps MAPK3, anticorps Mapk3, anticorps MAPK12, anticorps mapk3, anticorps Tc00.1047053509475.10, anticorps Tb927.8.3550, anticorps Mapk12, anticorps CEK1, anticorps MPK3

Sujet: Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase

Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3

ID gène: 5595

UniProt: P27361

Pathways: Signalisation MAPK, Signalisation RTK, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins