APC2 anticorps (N-Term)

N° du produit ABIN4886464

Détail du produit anti-APC2 anticorps

Antigène: APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))

Épitope: AA 51-90, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APC2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Adenomatous polyposis coli protein 2(APC2) detection. Tested with WB in Human.

Séquence: KHLQGKLEQE ARVLVSSGQT EVLEQLKALQ MDITSLYNLK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Adenomatous polyposis coli protein 2(APC2) detection. Tested with WB in Human.
Gene Name: APC2, WNT signaling pathway regulator
Protein Name: Adenomatous polyposis coli protein 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human APC2 (51-90aa KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK), different from the related mouse sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur APC2

Antigène: APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))

Autre désignation: APC2 (APC2 Produits)

Synonymes: anticorps APCL, anticorps AI852447, anticorps R75424, anticorps APC2, WNT signaling pathway regulator, anticorps adenomatosis polyposis coli 2, anticorps APC2, anticorps Apc2

Sujet: APC2, which is also called APCL, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.

Synonyms: APCL | APC2 | APC 2 | O95996

ID gène: 10297

Pathways: Signalisation WNT