Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

TUBB3 anticorps (C-Term)

TUBB3 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN4886757
  • Antigène Voir toutes TUBB3 Anticorps
    TUBB3 (Tubulin, beta 3 (TUBB3))
    Épitope
    • 19
    • 16
    • 16
    • 12
    • 7
    • 6
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 383-412, C-Term
    Reactivité
    • 123
    • 70
    • 63
    • 21
    • 7
    • 6
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 78
    • 49
    • 4
    • 1
    • 1
    Lapin
    Clonalité
    • 70
    • 63
    Polyclonal
    Conjugué
    • 78
    • 13
    • 7
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp TUBB3 est non-conjugé
    Application
    • 106
    • 41
    • 41
    • 36
    • 26
    • 25
    • 23
    • 15
    • 15
    • 14
    • 13
    • 6
    • 5
    • 4
    • 4
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    EQFTAMFRRK AFLHWYTGEG MDEMEFTEAE
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: tubulin beta 3 class III
    Protein Name: Tubulin beta-3 chain
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human Beta III Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product TUBB3 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Qu, Zhang, Du, Wang, Yang, Guo, Wang, Zhang, Xu: "Pim-3 is a Critical Risk Factor in Development and Prognosis of Prostate Cancer." dans: Medical science monitor : international medical journal of experimental and clinical research, Vol. 22, pp. 4254-4260, (2017) (PubMed).

    Zhu, Liu, Wang, Nie, He, Zhang, Liu, Su: "Lentiviral-mediated growth-associated protein-43 modification of bone marrow mesenchymal stem cells improves traumatic optic neuropathy in rats." dans: Molecular medicine reports, Vol. 12, Issue 4, pp. 5691-700, (2016) (PubMed).

    Cao, Li, Li, Xiong, Zhou, Fan, Yu, Mao: "The potential role of HMGB1 release in peritoneal dialysis-related peritonitis." dans: PLoS ONE, Vol. 8, Issue 1, pp. e54647, (2013) (PubMed).

  • Antigène
    TUBB3 (Tubulin, beta 3 (TUBB3))
    Autre désignation
    TUBB3 (TUBB3 Produits)
    Synonymes
    anticorps CDCBM, anticorps CFEOM3A, anticorps TUBB4, anticorps beta-4, anticorps TUBB3, anticorps 3200002H15Rik, anticorps M(beta)3, anticorps M(beta)6, anticorps tubb3, anticorps tubulin beta 3 class III, anticorps tubulin, beta 3 class III, anticorps tubulin beta 3 class III L homeolog, anticorps beta-tubulin 3, anticorps tubulin beta-3 chain, anticorps beta tubulin 3, anticorps TUBB3, anticorps Tubb3, anticorps tubb3, anticorps tubb3.L, anticorps LOC100581245, anticorps tub3
    Sujet
    Tubulin beta-3 chain is a protein that in humans is encoded by the TUBB3 gene. This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.

    Synonyms: beta 3 tubulin | beta-4 | CDCBM | CDCBM1 | CFEOM3A | CFEOM3 | FEOM3 | M(beta)3 | M(beta)6 | MC1R | Tubb 3 | TUBB3 | TUBB4 | Tubulin beta 3 | Tubulin beta 3 chain | Tubulin beta 4 | Tubulin beta-4 chain | Tubulin beta III | Tubulin beta-III | Q13509
    ID gène
    10381
    UniProt
    Q13509
    Pathways
    Dynamique des Microtubules, M Phase
Vous êtes ici:
Support technique