CYP27B1 anticorps

N° du produit ABIN4950731

Détail du produit anti-CYP27B1 anticorps

Antigène: CYP27B1 (Cytochrome P450, Family 27, Subfamily B, Polypeptide 1 (CYP27B1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP27B1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR of human CYP27B1 were used as the immunogen for the CYP27B1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CYP27B1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CYP27B1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CYP27B1

Antigène: CYP27B1 (Cytochrome P450, Family 27, Subfamily B, Polypeptide 1 (CYP27B1))

Autre désignation: CYP27B1 (CYP27B1 Produits)

Synonymes: anticorps cp2b, anticorps cyp1, anticorps cyp1alpha, anticorps cyp27b, anticorps p450c1, anticorps pddr, anticorps vdd1, anticorps vddr, anticorps vddri, anticorps vdr, anticorps CP2B, anticorps CYP1, anticorps CYP1alpha, anticorps CYP27B, anticorps P450c1, anticorps PDDR, anticorps VDD1, anticorps VDDR, anticorps VDDRI, anticorps VDR, anticorps Cyp40, anticorps Cp2b, anticorps Cyp1, anticorps Cyp27b, anticorps Pddr, anticorps Vdd1, anticorps Vddr, anticorps VddrI, anticorps Vdr, anticorps cytochrome P450 family 27 subfamily B member 1, anticorps cytochrome P450, family 27, subfamily B, polypeptide 1, anticorps cytochrome P450, family 27, subfamily b, polypeptide 1, anticorps cyp27b1, anticorps CYP27B1, anticorps Cyp27b1

Sujet: CYP27B1 belongs to the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I.

UniProt: O15528

Pathways: Metabolism of Steroid Hormones and Vitamin D