Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

EWSR1 anticorps

EWSR1 Reactivité: Humain, Souris, Rat WB, IHC (p), ICC, IHC (fro) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN4950965
  • Antigène Voir toutes EWSR1 Anticorps
    EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
    Reactivité
    • 74
    • 34
    • 27
    • 10
    • 8
    • 8
    • 7
    • 7
    • 5
    • 5
    • 4
    • 3
    • 2
    Humain, Souris, Rat
    Hôte
    • 62
    • 10
    • 2
    • 1
    Lapin
    Clonalité
    • 65
    • 10
    Polyclonal
    Conjugué
    • 52
    • 5
    • 3
    • 3
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp EWSR1 est non-conjugé
    Application
    • 66
    • 32
    • 14
    • 13
    • 7
    • 5
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
    Purification
    Antigen affinity
    Immunogène
    Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody.
    Isotype
    IgG
    Top Product
    Discover our top product EWSR1 Anticorps primaire
  • Indications d'application
    Optimal dilution of the EWSR1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 1-2 μg/mL,ICC (FFPE): 1-2 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Stock
    -20 °C
    Stockage commentaire
    After reconstitution, the EWSR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Antigène
    EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
    Autre désignation
    EWS / EWSR1 (EWSR1 Produits)
    Synonymes
    anticorps EWS, anticorps bK984G1.4, anticorps AU018891, anticorps Ews, anticorps Ewsh, anticorps EWSR1, anticorps fc04c01, anticorps wu:fc04c01, anticorps DKFZp459K1116, anticorps ewsr1, anticorps ewsr1.S, anticorps fb40b11, anticorps fusl, anticorps wu:fb40b11, anticorps wu:fb75g09, anticorps zgc:55864, anticorps EWS RNA binding protein 1, anticorps Ewing sarcoma breakpoint region 1, anticorps EWS RNA-binding protein 1, anticorps EWS RNA-binding protein 1a, anticorps EWS RNA binding protein 1 L homeolog, anticorps EWS RNA-binding protein 1b, anticorps EWSR1, anticorps Ewsr1, anticorps ewsr1a, anticorps ewsr1, anticorps ewsr1.L, anticorps ewsr1b
    Sujet
    This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.
    UniProt
    Q01844
Vous êtes ici:
Support technique