EWSR1 anticorps (Ewing Sarcoma Breakpoint Region 1)

Details for Product anti-EWSR1 Antibody No. ABIN4950965
Antigène
  • EWS
  • bK984G1.4
  • AU018891
  • Ews
  • Ewsh
  • EWSR1
  • fc04c01
  • wu:fc04c01
  • DKFZp459K1116
  • ewsr1
  • ewsr1.S
  • fb40b11
  • fusl
  • wu:fb40b11
  • wu:fb75g09
  • zgc:55864
  • EWS RNA binding protein 1
  • Ewing sarcoma breakpoint region 1
  • EWS RNA-binding protein 1
  • EWS RNA-binding protein 1a
  • EWS RNA binding protein 1 L homeolog
  • EWS RNA-binding protein 1b
  • EWSR1
  • Ewsr1
  • ewsr1a
  • ewsr1
  • ewsr1.L
  • ewsr1b
Reactivité
Humain, Souris, Rat (Rattus)
128
53
46
14
10
9
9
8
7
7
6
3
2
1
Hôte
Lapin
106
13
8
2
Clonalité
Polyclonal
Conjugué
Cet anticorp EWSR1 est non-conjugé
7
5
5
5
5
5
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
115
62
19
18
6
6
3
3
2
2
1
1
Options
Immunogène Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others EWSR1 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation EWS / EWSR1 (EWSR1 Antibody Extrait)
Sujet This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.
UniProt Q01844
Indications d'application Optimal dilution of the EWSR1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 1-2 μg/mL,ICC (FFPE): 1-2 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the EWSR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Ewing Sarcoma Breakpoint Region 1 (EWSR1) antibody (ABIN4950965) IHC testing of FFPE mouse testis with EWSR1 antibody. HIER: Boil the paraffin section...
Image no. 2 for anti-Ewing Sarcoma Breakpoint Region 1 (EWSR1) antibody (ABIN4950965) IHC testing of FFPE rat testis with EWSR1 antibody. HIER: Boil the paraffin sections ...
Image no. 3 for anti-Ewing Sarcoma Breakpoint Region 1 (EWSR1) antibody (ABIN4950965) Western blot testing of 1) rat brain, 2) rat testis, 3) human HeLa, 4) SKOV and 5) SW...
Avez-vous cherché autre chose?