FUT1 anticorps (Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group))

Details for Product anti-FUT1 Antibody No. ABIN4951103
Antigène
  • Futa
  • H
  • HH
  • HSC
  • Fut1
  • fucosyltransferase 1
  • fucosyltransferase 1 (H blood group)
  • Fut1
  • FUT1
Reactivité
Humain, Souris, Rat (Rattus)
31
12
6
2
2
2
2
2
2
1
1
1
Hôte
Lapin
26
7
5
Clonalité
Polyclonal
Conjugué
Cet anticorp FUT1 est non-conjugé
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
31
13
3
3
3
2
1
1
Options
Immunogène Amino acids EVDSRTPWRELQLHDWMSEEYADLRDPFLKL of human FUT1 were used as the immunogen for the FUT1 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others FUT1 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation FUT1 (FUT1 Antibody Extrait)
Sujet Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
UniProt P19526
Indications d'application Optimal dilution of the FUT1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the FUT1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1) antibody (ABIN4951103) Western blot testing of 1) rat brain, 2) human SW620 and 3) A549 lysate with FUT1 ant...
Image no. 2 for anti-Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1) antibody (ABIN4951103) IHC testing of FFPE rat intestine with FUT1 antibody. HIER: Boil the paraffin section...
Image no. 3 for anti-Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1) antibody (ABIN4951103) IHC testing of FFPE mouse intestine with FUT1 antibody. HIER: Boil the paraffin secti...
Avez-vous cherché autre chose?