HuD / ELAVL4 anticorps

Détails pour le produit réf. ABIN4951387
Antigène
Reactivité
Humain, Souris, Rat (Rattus)
Hôte
Lapin
Clonalité
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Options
Immunogène Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Sujet HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is anRNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.
UniProt P26378
Indications d'application Optimal dilution of the HuD antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the HuD antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-HuD / ELAVL4 antibody (ABIN4951387) IHC testing of FFPE rat brain with HuD antibody. HIER: Boil the paraffin sections in ...
Image no. 2 for anti-HuD / ELAVL4 antibody (ABIN4951387) IHC testing of FFPE mouse brain with HuD antibody. HIER: Boil the paraffin sections i...
Image no. 3 for anti-HuD / ELAVL4 antibody (ABIN4951387) Western blot testing of 1) rat brain, 2) mouse brain and 3) human U87 lysate with HuD...
Avez-vous cherché autre chose?