IDH1 anticorps (Isocitrate Dehydrogenase 1 (NADP+), Soluble)

Details for Product anti-IDH1 Antibody No. ABIN4951400
Antigène
  • IDCD
  • IDH
  • IDP
  • IDPC
  • PICD
  • NADP-CICDH
  • AI314845
  • AI788952
  • E030024J03Rik
  • Id-1
  • Idh-1
  • Idpc
  • cb876
  • fm90e09
  • im:7143416
  • wu:fm90e09
  • isocitrate dehydrogenase (NADP(+)) 1, cytosolic
  • isocitrate dehydrogenase 1 (NADP+), soluble
  • isocitrate dehydrogenase 1 (NADP+) L homeolog
  • IDH1
  • Idh1
  • idh1.L
  • idh1
Reactivité
Humain, Souris, Rat (Rattus)
167
110
70
11
10
8
5
5
5
4
4
4
2
2
1
1
1
1
Hôte
Lapin
133
59
9
2
Clonalité
Polyclonal
Conjugué
Cet anticorp IDH1 est non-conjugé
13
9
8
3
3
3
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
161
78
68
42
40
27
21
13
11
10
7
4
4
2
2
2
1
Options
Immunogène Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK of human IDH1 were used as the immunogen for the IDH1 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation IDH1 (IDH1 Antibody Extrait)
Sujet Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
UniProt O75874
Indications d'application Optimal dilution of the IDH1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the IDH1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1) antibody (ABIN4951400) Western blot testing of 1) rat lung, 2) rat kidney, 3) rat brain, 4) human HeLa, 5) S...
Image no. 2 for anti-Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1) antibody (ABIN4951400) IHC testing of FFPE mouse testis with IDH1 antibody. HIER: Boil the paraffin sections...
Image no. 3 for anti-Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1) antibody (ABIN4951400) IHC testing of FFPE rat testis with IDH1 antibody. HIER: Boil the paraffin sections i...
Image no. 4 for anti-Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1) antibody (ABIN4951400) IHC testing of frozen rat small intestine tissue with IDH1 antibody.
Avez-vous cherché autre chose?