IDH1 anticorps

N° du produit ABIN4951400

Détail du produit anti-IDH1 anticorps

Antigène: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IDH1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Purification: Antigen affinity

Immunogène: Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK of human IDH1 were used as the immunogen for the IDH1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the IDH1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the IDH1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur IDH1

Antigène: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Autre désignation: IDH1 (IDH1 Produits)

Synonymes: anticorps IDCD, anticorps IDH, anticorps IDP, anticorps IDPC, anticorps PICD, anticorps NADP-CICDH, anticorps AI314845, anticorps AI788952, anticorps E030024J03Rik, anticorps Id-1, anticorps Idh-1, anticorps Idpc, anticorps cb876, anticorps fm90e09, anticorps im:7143416, anticorps wu:fm90e09, anticorps F23E12.180, anticorps F23E12_180, anticorps IDH-I, anticorps NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1, anticorps isocitrate dehydrogenase 1, anticorps isocitrate dehydrogenase I, anticorps isocitrate dehydrogenase (NADP(+)) 1, cytosolic, anticorps isocitrate dehydrogenase 1 (NADP+), soluble, anticorps isocitrate dehydrogenase 1 (NADP+) L homeolog, anticorps isocitrate dehydrogenase 1, anticorps IDH1, anticorps Idh1, anticorps idh1.L, anticorps idh1

Sujet: Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

UniProt: O75874

Pathways: L'effet Warburg