IKZF1 anticorps

N° du produit ABIN4951433

Détail du produit anti-IKZF1 anticorps

Antigène: IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IKZF1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids LKEEHRAYDLLRAASENSQDALRVVSTSGEQM of human IKZF1 were used as the immunogen for the IKAROS antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the IKAROS antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the IKAROS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur IKZF1

Antigène: IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))

Autre désignation: IKAROS / IKZF1 (IKZF1 Produits)

Synonymes: anticorps Hs.54452, anticorps IK1, anticorps IKAROS, anticorps LYF1, anticorps PRO0758, anticorps ZNFN1A1, anticorps hIk-1, anticorps RGD1562979, anticorps ikaros, anticorps znfn1a1, anticorps ik1, anticorps lyf1, anticorps hik-1, anticorps pro0758, anticorps hs.54452, anticorps MGC108252, anticorps 5832432G11Rik, anticorps Ikaros, anticorps LyF-1, anticorps Zfpn1a1, anticorps Znfn1a1, anticorps hlk-1, anticorps mKIAA4227, anticorps ikzf1, anticorps IKAROS family zinc finger 1, anticorps IKAROS family zinc finger 1 (Ikaros), anticorps IKZF1, anticorps Ikzf1, anticorps ikzf1

Sujet: DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.

UniProt: Q13422

Pathways: Production of Molecular Mediator of Immune Response