IKZF1 anticorps (IKAROS Family Zinc Finger 1 (Ikaros))

Details for Product anti-IKZF1 Antibody No. ABIN4951433
Antigène
  • Hs.54452
  • IK1
  • IKAROS
  • LYF1
  • PRO0758
  • ZNFN1A1
  • hIk-1
  • RGD1562979
  • ikaros
  • znfn1a1
  • ik1
  • lyf1
  • hik-1
  • pro0758
  • hs.54452
  • MGC108252
  • 5832432G11Rik
  • Ikaros
  • LyF-1
  • Zfpn1a1
  • Znfn1a1
  • hlk-1
  • mKIAA4227
  • ikzf1
  • IKAROS family zinc finger 1
  • IKAROS family zinc finger 1 (Ikaros)
  • IKZF1
  • Ikzf1
  • ikzf1
Reactivité
Humain, Souris, Rat (Rattus)
105
52
42
7
6
5
5
5
4
2
1
1
1
Hôte
Lapin
85
16
8
Clonalité
Polyclonal
Conjugué
Cet anticorp IKZF1 est non-conjugé
7
6
6
5
3
3
2
2
2
2
2
2
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
85
40
34
26
13
12
11
9
5
2
2
2
1
1
Options
Immunogène Amino acids LKEEHRAYDLLRAASENSQDALRVVSTSGEQM of human IKZF1 were used as the immunogen for the IKAROS antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others IKZF1 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation IKAROS / IKZF1 (IKZF1 Antibody Extrait)
Sujet DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.
UniProt Q13422
Pathways Production of Molecular Mediator of Immune Response
Indications d'application Optimal dilution of the IKAROS antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the IKAROS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1) antibody (ABIN4951433) IHC testing of FFPE rat spleen with IKAROS antibody. HIER: Boil the paraffin sections...
Image no. 2 for anti-IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1) antibody (ABIN4951433) IHC testing of FFPE mouse spleen with IKAROS antibody. HIER: Boil the paraffin sectio...
Image no. 3 for anti-IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1) antibody (ABIN4951433) Western blot testing of human HeLa cell lysate with IKAROS antibody. Expected molecul...
Avez-vous cherché autre chose?