KCNIP2 anticorps

N° du produit ABIN4951519

Détail du produit anti-KCNIP2 anticorps

Antigène: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNIP2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR of human KChIP2 were used as the immunogen for the KChIP2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the KChIP2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the KChIP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur KCNIP2

Antigène: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Autre désignation: KChIP2 (KCNIP2 Produits)

Synonymes: anticorps KCHIP2, anticorps KCNIP2, anticorps Kchip2, anticorps KChIP2, anticorps kchip2, anticorps si:ch73-173h19.2, anticorps potassium voltage-gated channel interacting protein 2, anticorps Kv channel-interacting protein 2, anticorps Kv channel interacting protein 2 S homeolog, anticorps Kv channel interacting protein 2, anticorps KCNIP2, anticorps Kcnip2, anticorps kcnip2.S, anticorps kcnip2

Sujet: Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.

UniProt: Q9NS61