KCNA3 anticorps

N° du produit ABIN4951520

Détail du produit anti-KCNA3 anticorps

Antigène: KCNA3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNA3 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ of human KCNA3 were used as the immunogen for the KCNA3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the KCNA3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the KCNA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur KCNA3

Antigène: KCNA3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3))

Autre désignation: KCNA3 / Kv1.3 (KCNA3 Produits)

Synonymes: anticorps Kv1.3-glyb, anticorps kv1.3, anticorps Kv1.3B, anticorps kcna3b-a, anticorps HGK5, anticorps HLK3, anticorps HPCN3, anticorps HUKIII, anticorps KV1.3, anticorps MK3, anticorps PCN3, anticorps Kca1-3, anticorps Kv1.3, anticorps Mk-3, anticorps cKv1.1, anticorps potassium voltage-gated channel subfamily A member 3, anticorps potassium channel, voltage gated shaker related subfamily A, member 3 S homeolog, anticorps potassium voltage-gated channel, shaker-related subfamily, member 3, anticorps KCNA3, anticorps kcna3.S, anticorps Kcna3

Sujet: Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.

UniProt: P22001