KCNA3 anticorps (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3)

Details for Product anti-KCNA3 Antibody No. ABIN4951520
Antigène
  • Kv1.3-glyb
  • kv1.3
  • Kv1.3B
  • kcna3b-a
  • HGK5
  • HLK3
  • HPCN3
  • HUKIII
  • KV1.3
  • MK3
  • PCN3
  • Kca1-3
  • Kv1.3
  • Mk-3
  • cKv1.1
  • potassium voltage-gated channel subfamily A member 3
  • potassium channel, voltage gated shaker related subfamily A, member 3 S homeolog
  • potassium voltage-gated channel, shaker-related subfamily, member 3
  • KCNA3
  • kcna3.S
  • Kcna3
Reactivité
Humain, Souris, Rat (Rattus)
105
77
60
7
7
6
6
2
2
1
1
Hôte
Lapin
101
25
Clonalité
Polyclonal
Conjugué
Cet anticorp KCNA3 est non-conjugé
6
5
4
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
92
45
39
36
17
13
4
2
2
2
2
1
1
Options
Immunogène Amino acids EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ of human KCNA3 were used as the immunogen for the KCNA3 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others KCNA3 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation KCNA3 / Kv1.3 (KCNA3 Antibody Extrait)
Sujet Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.
UniProt P22001
Indications d'application Optimal dilution of the KCNA3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the KCNA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3) antibody (ABIN4951520) Western blot testing of 1) rat brain, 2) mouse brain, human 3) K562, 4) HeLa and 5) 2...
Avez-vous cherché autre chose?