Otoferlin anticorps

N° du produit ABIN4952006

Détail du produit anti-Otoferlin anticorps

Antigène: Otoferlin (OTOF)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Otoferlin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ of human OTOF were used as the immunogen for the Otoferlin antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Otoferlin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Otoferlin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Otoferlin

Antigène: Otoferlin (OTOF)

Autre désignation: Otoferlin (OTOF Produits)

Synonymes: anticorps OTOF, anticorps Otof, anticorps AUNB1, anticorps DFNB6, anticorps DFNB9, anticorps FER1L2, anticorps NSRD9, anticorps fj34b10, anticorps si:dkey-181f18.3, anticorps wu:fj34b10, anticorps otoferlin, anticorps putative otoferlin, anticorps otoferlin a, anticorps OTOF, anticorps LOC5565414, anticorps CpipJ_CPIJ002471, anticorps CpipJ_CPIJ010863, anticorps Smp_163750, anticorps otof, anticorps Otof, anticorps otofa

Sujet: Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.

UniProt: Q9HC10

Pathways: Sensory Perception of Sound, Synaptic Vesicle Exocytosis