PTP4A2 anticorps

N° du produit ABIN4952318

Détail du produit anti-PTP4A2 anticorps

Antigène: PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTP4A2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Purification: Antigen affinity

Immunogène: Amino acids TTLVRVCDATYDKAPVEKEGIHVLDWPFDD of human PTP4A2 were used as the immunogen for the PTP4A2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the PTP4A2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the PTP4A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PTP4A2

Antigène: PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))

Autre désignation: PTP4A2 (PTP4A2 Produits)

Synonymes: anticorps wu:fc05f09, anticorps wu:fi84b06, anticorps zgc:101724, anticorps MGC53390, anticorps MGC80084, anticorps MGC132077, anticorps PTP4A2, anticorps ptp4a2, anticorps Prl-2, anticorps HH13, anticorps HH7-2, anticorps HU-PP-1, anticorps OV-1, anticorps PRL-2, anticorps PRL2, anticorps PTP4A, anticorps PTPCAAX2, anticorps ptp-IV1a, anticorps ptp-IV1b, anticorps protein tyrosine phosphatase type IVA, member 2b, anticorps protein tyrosine phosphatase 4a2, anticorps protein tyrosine phosphatase type IVA, member 2, anticorps protein tyrosine phosphatase type IVA, member 2 L homeolog, anticorps ptp4a2b, anticorps ptp4a2, anticorps PTP4A2, anticorps ptp4a2.L, anticorps Ptp4a2

Sujet: Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.

UniProt: Q12974