SLC22A2 anticorps

N° du produit ABIN4952582

Détail du produit anti-SLC22A2 anticorps

Antigène: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC22A2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN of human SLC22A2 were used as the immunogen for the SLC22A2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the SLC22A2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the SLC22A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur SLC22A2

Antigène: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Autre désignation: SLC22A2 (SLC22A2 Produits)

Synonymes: anticorps OCT2, anticorps Oct2, anticorps Orct2, anticorps OCT2r, anticorps rOCT2, anticorps Pou2f2, anticorps OCT2P, anticorps oct1, anticorps wu:fc01b11, anticorps zgc:64076, anticorps slc22a2, anticorps solute carrier family 22 member 2, anticorps solute carrier family 22 (organic cation transporter), member 2, anticorps POU class 2 homeobox 2, anticorps solute carrier family 22 (organic cation transporter), member 2 L homeolog, anticorps SLC22A2, anticorps Slc22a2, anticorps POU2F2, anticorps LOC521027, anticorps slc22a2, anticorps slc22a2.L

Sujet: SLC22A2 is also known as OCT2. It is mapped to 6q25.3. Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.

UniProt: O15244