TAP1 anticorps

N° du produit ABIN4952781

Détail du produit anti-TAP1 anticorps

Antigène: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TAP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN of human TAP1 were used as the immunogen for the TAP1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the TAP1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the TAP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur TAP1

Antigène: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Autre désignation: TAP1 (TAP1 Produits)

Synonymes: anticorps ABC17, anticorps ABCB2, anticorps APT1, anticorps D6S114E, anticorps PSF-1, anticorps PSF1, anticorps RING4, anticorps TAP1*0102N, anticorps TAP1N, anticorps abc17, anticorps abcb2, anticorps apt1, anticorps psf1, anticorps ring4, anticorps tap1a, anticorps tap1n, anticorps Abcb2, anticorps Ham-1, anticorps Ham1, anticorps MTP1, anticorps TAP, anticorps Tap-1, anticorps Y3, anticorps Cim, anticorps transporter 1, ATP binding cassette subfamily B member, anticorps transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) L homeolog, anticorps transporter 1, ATP-binding cassette, sub-family B (MDR/TAP), anticorps TAP1, anticorps tap1.L, anticorps Tap1

Sujet: Transporter associated with Antigen Processing 1 is a protein that in humans is encoded by the TAP1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene.

UniProt: Q03518

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process