ABCC1 anticorps (C-Term)

N° du produit ABIN5518718

Détail du produit anti-ABCC1 anticorps

Antigène: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Épitope: AA 1493-1528, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCC1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Multidrug resistance-associated protein 1(ABCC1) detection. Tested with WB in Human.

Séquence: DYTRVIVLDK GEIQEYGAPS DLLQQRGLFY SMAKDA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Multidrug resistance-associated protein 1(ABCC1) detection. Tested with WB in Human.
Gene Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Protein Name: Multidrug resistance-associated protein 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-ABCC1 (ABIN5518718)

Duan, Di: "Acetazolamide Suppresses Multi-Drug Resistance-Related Protein 1 and P-Glycoprotein Expression by Inhibiting Aquaporins Expression in a Mesial Temporal Epilepsy Rat Model." dans: Medical science monitor : international medical journal of experimental and clinical research, Vol. 23, pp. 5818-5825, (2018) (PubMed).

Chen, Wei, Cheng, Xie, Wang, Yi, Tian, Liu, Wang, Zhang: "Characteristics of doxorubicin-selected multidrug-resistant human leukemia HL-60 cells with tolerance to arsenic trioxide and contribution of leukemia stem cells." dans: Oncology letters, Vol. 15, Issue 1, pp. 1255-1262, (2018) (PubMed).

Gao, Xu, Qiu: "Enhanced combination therapy effect on paclitaxel-resistant carcinoma by chloroquine co-delivery via liposomes." dans: International journal of nanomedicine, Vol. 10, pp. 6615-32, (2016) (PubMed).

Zhang, Yang, Wang, Liu, Wang, Xie, Chen, Dong, Li: "Enhanced autophagy reveals vulnerability of P-gp mediated epirubicin resistance in triple negative breast cancer cells." dans: Apoptosis : an international journal on programmed cell death, Vol. 21, Issue 4, pp. 473-88, (2016) (PubMed).

Détails sur ABCC1

Antigène: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Autre désignation: ABCC1 (ABCC1 Produits)

Synonymes: anticorps ABC29, anticorps ABCC, anticorps GS-X, anticorps MRP, anticorps MRP1, anticorps Abcc1a, anticorps Abcc1b, anticorps Mdrap, anticorps Mrp1, anticorps Avcc1a, anticorps Mrp, anticorps ABCC13, anticorps ATP binding cassette subfamily C member 1, anticorps ATP-binding cassette, sub-family C (CFTR/MRP), member 1, anticorps multidrug resistance-associated protein 1, anticorps ABCC1, anticorps Abcc1, anticorps LOC100152428, anticorps LOC100346553

Sujet: Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.

Synonyms: ABCC1 | Leukotriene C transporter | Leukotriene C(4) transporter | LTC4 transporter | MRP | MRP1 | MRP-1 | P33527

ID gène: 4363

UniProt: P33527

Pathways: SARS-CoV-2 Protein Interactome