KPNA2 anticorps (N-Term)

N° du produit ABIN5518930

Détail du produit anti-KPNA2 anticorps

Antigène: KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))

Épitope: AA 2-46, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KPNA2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Importin subunit alpha-1(KPNA2) detection. Tested with WB in Human.

Séquence: STNENANTPA ARLHRFKNKG KDSTEMRRRR IEVNVELRKA KKDDQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Importin subunit alpha-1(KPNA2) detection. Tested with WB in Human.
Gene Name: karyopherin subunit alpha 2
Protein Name: Importin subunit alpha-1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human KPNA2 (2-46aa STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQ), different from the related mouse sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur KPNA2

Antigène: KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))

Autre désignation: KPNA2 (KPNA2 Produits)

Synonymes: anticorps IPOA1, anticorps QIP2, anticorps RCH1, anticorps SRP1alpha, anticorps ima2, anticorps importin, anticorps 2410044B12Rik, anticorps PTAC58, anticorps Rch1, anticorps ipoa1, anticorps kpna2, anticorps qip2, anticorps rch1, anticorps srp1alpha, anticorps hm:zeh0389, anticorps hm:zeh0389r, anticorps zgc:113902, anticorps zgc:86945, anticorps karyopherin subunit alpha 2, anticorps importin subunit alpha-2, anticorps Importin subunit alpha-2, anticorps karyopherin (importin) alpha 2, anticorps karyopherin alpha-2 subunit like L homeolog, anticorps karyopherin alpha 2 (RAG cohort 1, importin alpha 1), anticorps KPNA2, anticorps EDI_246290, anticorps EDI_335040, anticorps ima2, anticorps Kpna2, anticorps kpna2.L, anticorps kpna2

Sujet: Importin subunit alpha-2 is a protein that in humans is encoded by the KPNA2 gene. The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination.

Synonyms: Importin subunit alpha-1, Karyopherin subunit alpha-2, RAG cohort protein 1, SRP1-alpha, KPNA2, RCH1, SRP1

ID gène: 3838

UniProt: P52292

Pathways: M Phase, Protein targeting to Nucleus