ASL anticorps

N° du produit ABIN5518971

Détail du produit anti-ASL anticorps

Antigène: ASL (Argininosuccinate Lyase (ASL))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASL est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Adenylosuccinate Lyase detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: YTHLQRAQPI RWSHWILSHA VALTRDSERL LEVRKRIN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Adenylosuccinate Lyase detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: argininosuccinate lyase
Protein Name: Argininosuccinate lyase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human Adenylosuccinate Lyase (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN).

Isotype: IgG

Information d'application

Indications d'application: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ASL

Antigène: ASL (Argininosuccinate Lyase (ASL))

Autre désignation: ASL (ASL Produits)

Synonymes: anticorps ASAL, anticorps 2510006M18Rik, anticorps zgc:63532, anticorps BA4879, anticorps PSPTO0125, anticorps Adl, anticorps Asl, anticorps argininosuccinate lyase, anticorps argininosuccinate lyase ArgH, anticorps adenylosuccinate lyase, anticorps argininosuccinate lyase L homeolog, anticorps ASL, anticorps Asl, anticorps asl, anticorps argH2, anticorps argH, anticorps arg7, anticorps CNC04420, anticorps STHERM_c13370, anticorps Adsl, anticorps asl.L, anticorps ARG7

Sujet: ASL (argininosuccinatelyase, also known as argininosuccinase) is an enzyme that catalyzes the reversible breakdown of argininosuccinate (ASA) producing the amino acid arginine and dicarboxylic acid fumarate. Located in liver cytosol, ASL is the fourth enzyme of the urea cycle and involved in the biosynthesis of arginine in all species and the production of urea in ureotelic species. Mutations in ASL, resulting low activity of the enzyme, increase levels of urea in the body and result in various side effects. The ASL gene is located on chromosome 7 between the centromere (junction of the long and short arm) and the long (q) arm at position 11.2, from base pair 64,984,963 to base pair 65,002,090.

Synonyms: Argininosuccinate lyase, ASAL, Arginosuccinase, ASL

ID gène: 435

UniProt: P04424

Pathways: Response to Growth Hormone Stimulus