AGO2 anticorps

N° du produit ABIN5646978

Détail du produit anti-AGO2 anticorps

Antigène: AGO2 (Argonaute 2 (AGO2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGO2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: Prior to reconstitution, store at 4°C. After reconstitution, the AGO2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur AGO2

Antigène: AGO2 (Argonaute 2 (AGO2))

Autre désignation: AGO2 / Argonaute 2 (AGO2 Produits)

Synonymes: anticorps EIF2C2, anticorps T19E23.7, anticorps T19E23_7, anticorps argonaute 2, anticorps Q10, anticorps Eif2c2, anticorps Argonaute2, anticorps eif2c1, anticorps eif2c2, anticorps 1110029L17Rik, anticorps 2310051F07Rik, anticorps AI225898, anticorps AL022874, anticorps AW546247, anticorps ENSMUSG00000072493, anticorps Gerp95, anticorps Gm10365, anticorps mKIAA4215, anticorps AGO2, anticorps AG02, anticorps AGO 2, anticorps Ago-2, anticorps Ago2, anticorps CG13452, anticorps CG7439, anticorps Dm Ago2, anticorps Dmel\\CG7439, anticorps ago, anticorps ago-2, anticorps ago2, anticorps dAGO2, anticorps dAgo2, anticorps eIF2C2, anticorps argonaute 2, RISC catalytic component, anticorps Argonaute family protein, anticorps argonaute 2, RISC catalytic component L homeolog, anticorps argonaute RISC catalytic subunit 2, anticorps argonaute RISC catalytic component 2, anticorps Argonaute 2, anticorps AGO2, anticorps Ago2, anticorps ago2.L, anticorps ago2

Sujet: Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9UKV8

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Ribonucleoprotein Complex Subunit Organization