ABCB10 anticorps (AA 640-678)

N° du produit ABIN5647439

Détail du produit anti-ABCB10 anticorps

Antigène: ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))

Épitope: AA 640-678

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCB10 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 640-678 (QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR) from the human protein were used as the immunogen for the ABCB10 antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: Prior to reconstitution, store at 4°C. After reconstitution, the ABCB10 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ABCB10

Antigène: ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))

Autre désignation: ABCB10 (ABCB10 Produits)

Synonymes: anticorps EST20237, anticorps M-ABC2, anticorps MTABC2, anticorps Abc-me, anticorps Abcb12, anticorps ABCB10, anticorps si:dkey-162b3.3, anticorps GB10581, anticorps ATP binding cassette subfamily B member 10, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 10, anticorps ATP-binding cassette sub-family B member 10, mitochondrial, anticorps ABCB10, anticorps Abcb10, anticorps abcb10, anticorps LOC552744

Sujet: ABCB10, also known as M-ABC2, is expressed as a 65-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

UniProt: Q9NRK6