ABCC1 anticorps (AA 1493-1528)

N° du produit ABIN5647441

Détail du produit anti-ABCC1 anticorps

Antigène: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Épitope: AA 1493-1528

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCC1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 1493-1528 (DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA) from the human protein were used as the immunogen for the ABCC1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ABCC1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ABCC1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ABCC1

Antigène: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Autre désignation: MRP1 / ABCC1 (ABCC1 Produits)

Synonymes: anticorps ABC29, anticorps ABCC, anticorps GS-X, anticorps MRP, anticorps MRP1, anticorps Abcc1a, anticorps Abcc1b, anticorps Mdrap, anticorps Mrp1, anticorps Avcc1a, anticorps Mrp, anticorps ABCC13, anticorps ATP binding cassette subfamily C member 1, anticorps ATP-binding cassette, sub-family C (CFTR/MRP), member 1, anticorps multidrug resistance-associated protein 1, anticorps ABCC1, anticorps Abcc1, anticorps LOC100152428, anticorps LOC100346553

Sujet: Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.

UniProt: P33527

Pathways: SARS-CoV-2 Protein Interactome