L1CAM anticorps

N° du produit ABIN5647757

Détail du produit anti-L1CAM anticorps

Antigène: L1CAM (L1 Cell Adhesion Molecule (L1CAM))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp L1CAM est non-conjugé

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW were used as the immunogen for the L1CAM antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the L1CAM antibody should be determined by the researcher.\. IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the L1CAM antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur L1CAM

Antigène: L1CAM (L1 Cell Adhesion Molecule (L1CAM))

Autre désignation: L1CAM / NCAM-L1 / CD171 (L1CAM Produits)

Synonymes: anticorps l1cam-a, anticorps CAML1, anticorps CD171, anticorps HSAS, anticorps HSAS1, anticorps MASA, anticorps MIC5, anticorps N-CAM-L1, anticorps N-CAML1, anticorps NCAM-L1, anticorps S10, anticorps SPG1, anticorps L1, anticorps Hsas, anticorps Hyd, anticorps NCAML1, anticorps L1 cell adhesion molecule S homeolog, anticorps L1 cell adhesion molecule, anticorps l1cam.S, anticorps L1CAM, anticorps L1cam

Sujet: L1, also known as L1CAM, is a transmembrane protein member of the L1 protein family, encoded by the L1CAM gene. The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons.

UniProt: P32004

Pathways: Synaptic Membrane