KDM5B anticorps (AA 641-685)

N° du produit ABIN5647866

Détail du produit anti-KDM5B anticorps

Antigène: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Épitope: AA 641-685

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KDM5B est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids 641-685 (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL) from the human protein were used as the immunogen for the KDM5B antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the KDM5B antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur KDM5B

Antigène: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Autre désignation: KDM5B / Jarid1B (KDM5B Produits)

Synonymes: anticorps jarid1b, anticorps jarid1ba, anticorps id:ibd5050, anticorps wu:fd15c05, anticorps cb264, anticorps jarid1bb, anticorps plu1, anticorps wu:fc44h11, anticorps zgc:85741, anticorps JARID1B, anticorps CT31, anticorps PLU-1, anticorps PLU1, anticorps PUT1, anticorps RBBP2H1A, anticorps 2010009J12Rik, anticorps 2210016I17Rik, anticorps AW556288, anticorps D1Ertd202e, anticorps Jarid1b, anticorps Plu1, anticorps Rb-Bp2, anticorps mKIAA4034, anticorps RGD1565602, anticorps lysine (K)-specific demethylase 5Ba, anticorps lysine (K)-specific demethylase 5Bb, anticorps lysine demethylase 5B, anticorps lysine (K)-specific demethylase 5B, anticorps kdm5ba, anticorps kdm5bb, anticorps KDM5B, anticorps Kdm5b

Sujet: Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.

UniProt: Q9UGL1

Pathways: L'effet Warburg