PDGFB anticorps (AA 89-129)

N° du produit ABIN5647896

Cet anticorps Lapin Polyclonal détecte spécifiquement PDGFB dans WB. Il présente une réactivité avec des échantillons de Rat et Souris.

Aperçu rapide pour PDGFB anticorps (AA 89-129) (ABIN5647896)

Antigène: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Reactivité: Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDGFB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDGFB anticorps

Épitope: AA 89-129

Fonction: PDGF beta Antibody

Séquence: AEPAMIAECK TRTEVFEISR RLIDRTNANF LVWPPCVEVQ R

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity

Immunogène: Amino acids 89-129 (AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR) from the human protein were used as the immunogen for the PDGF beta antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the PDGF beta antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the PDGF beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur PDGFB

Antigène: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Autre désignation: PDGF beta

Sujet: Platelet-derived growth factor subunit B is a protein that in humans is encoded by the PDGFB gene. The protein encoded by this gene is a member of the platelet-derived growth factor family. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. This gene is mapped to 22q13.1. Growth factor plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. This gene plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

UniProt: P01127

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling