GFI1 anticorps

N° du produit ABIN5693139

Détail du produit anti-GFI1 anticorps

Antigène: GFI1 (Growth Factor Independent 1 (GFI1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GFI1 est non-conjugé

Application: Immunohistochemistry (IHC)

Marque: Picoband™

Séquence: NLITHSRKHT GFKPFGCDLC GKGFQRKVDL RRHRETQH

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for GFI1 detection. Tested with IHC-P in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH).

Information d'application

Indications d'application:

Recommended Detection Systems: HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur GFI1

Antigène: GFI1 (Growth Factor Independent 1 (GFI1))

Autre désignation: GFI1 (GFI1 Produits)

Synonymes: anticorps AW495828, anticorps Gfi-1, anticorps Pal-1, anticorps Pal1, anticorps GFI1, anticorps GFI-1, anticorps GFI1A, anticorps SCN2, anticorps ZNF163, anticorps growth factor independent 1, anticorps growth factor independent 1 transcriptional repressor, anticorps Gfi1, anticorps GFI1

Sujet:

Synonyms: Zinc finger protein Gfi-1, Growth factor independent protein 1, Zinc finger protein 163, GFI1, ZNF163

Background: Zinc finger protein Gfi-1 is a protein that in humans is encoded by the GFI1 gene. This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.

UniProt: Q99684