L1CAM anticorps
-
- Antigène Voir toutes L1CAM Anticorps
- L1CAM (L1 Cell Adhesion Molecule (L1CAM))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp L1CAM est non-conjugé
-
Application
- Immunohistochemistry (IHC)
- Séquence
- NMVITWKPLR WMDWNAPQVQ YRVQWRPQGT RGPW
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for L1CAM detection. Tested with IHC-P in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW).
- Top Product
- Discover our top product L1CAM Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- L1CAM (L1 Cell Adhesion Molecule (L1CAM))
- Autre désignation
- L1CAM (L1CAM Produits)
- Synonymes
- anticorps l1cam-a, anticorps CAML1, anticorps CD171, anticorps HSAS, anticorps HSAS1, anticorps MASA, anticorps MIC5, anticorps N-CAM-L1, anticorps N-CAML1, anticorps NCAM-L1, anticorps S10, anticorps SPG1, anticorps L1, anticorps Hsas, anticorps Hyd, anticorps NCAML1, anticorps L1 cell adhesion molecule S homeolog, anticorps L1 cell adhesion molecule, anticorps l1cam.S, anticorps L1CAM, anticorps L1cam
- Sujet
-
Synonyms: Neural cell adhesion molecule L1, N-CAM-L1, NCAM-L1, CD171, L1CAM, CAML1, MIC5
Background: L1, also known as L1CAM, is a transmembrane protein member of the L1 protein family, encoded by the L1CAM gene. The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons.
- UniProt
- P32004
- Pathways
- Synaptic Membrane
-