STAR anticorps

N° du produit ABIN5708349

Détail du produit anti-STAR anticorps

Antigène: STAR (Steroidogenic Acute Regulatory Protein (STAR))

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STAR est non-conjugé

Application: Western Blotting (WB)

Réactivité croisée (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogène: Amino acids EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD from the human protein were used as the immunogen for the StAR antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the StAR antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the StAR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur STAR

Antigène: STAR (Steroidogenic Acute Regulatory Protein (STAR))

Autre désignation: StAR / Steroidogenic acute regulatory protein (STAR Produits)

Synonymes: anticorps STARD1, anticorps AV363654, anticorps D8Ertd419e, anticorps star, anticorps LOC100219165, anticorps StARD1, anticorps steroidogenic acute regulatory protein, anticorps steroidogenic acute regulatory protein L homeolog, anticorps STAR, anticorps Star, anticorps star, anticorps star.L

Sujet: The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.

UniProt: P49675

Pathways: Metabolism of Steroid Hormones and Vitamin D, Response to Growth Hormone Stimulus, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis