FZD3 anticorps

N° du produit ABIN5708451

Détail du produit anti-FZD3 anticorps

Antigène: FZD3 (Frizzled Family Receptor 3 (FZD3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL from the human protein were used as the immunogen for the FZD3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the FZD3 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the FZD3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur FZD3

Antigène: FZD3 (Frizzled Family Receptor 3 (FZD3))

Autre désignation: FZD3 / Frizzled 3 (FZD3 Produits)

Synonymes: anticorps Fz-3, anticorps FZ-3, anticorps fz3, anticorps Xfz3, anticorps frz3, anticorps hfz3, anticorps frz-3, anticorps frizzled3, anticorps frizzled-3, anticorps FZD3, anticorps AU020229, anticorps D930050A07Rik, anticorps Fz3, anticorps fz9, anticorps fzd3, anticorps zg09, anticorps fzd3l, anticorps frizzled class receptor 3, anticorps frizzled class receptor 3 L homeolog, anticorps frizzled class receptor 3a, anticorps frizzled class receptor 3b, anticorps FZD3, anticorps fzd3, anticorps fzd3.L, anticorps Fzd3, anticorps fzd3a, anticorps fzd3b

Sujet: Frizzled-3 is a protein that in humans is encoded by the FZD3 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.

UniProt: Q9NPG1

Pathways: Signalisation WNT, Tube Formation