PRIM2 anticorps

N° du produit ABIN629585

Détail du produit anti-PRIM2 anticorps

Antigène: PRIM2 (Primase, DNA, Polypeptide 2 (58kDa) (PRIM2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRIM2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PRIM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRIM2 Blocking Peptide, catalog no. 33R-7496, is also available for use as a blocking control in assays to test for specificity of this PRIM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRIM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRIM2

Antigène: PRIM2 (Primase, DNA, Polypeptide 2 (58kDa) (PRIM2))

Autre désignation: PRIM2 (PRIM2 Produits)

Synonymes: anticorps prim2a, anticorps AI323589, anticorps Pola3, anticorps PRIM2A, anticorps p58, anticorps DNA primase subunit 2, anticorps DNA primase, p58 subunit, anticorps prim2, anticorps Prim2, anticorps PRIM2

Sujet: The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Telomere Maintenance, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, SARS-CoV-2 Protein Interactome