Pyrophosphatase (Inorganic) 1 (PPA1) anticorps

N° du produit ABIN629633

Détail du produit

Antigène: Pyrophosphatase (Inorganic) 1 (PPA1)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PPA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPA1 Blocking Peptide, catalog no. 33R-7346, is also available for use as a blocking control in assays to test for specificity of this PPA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Pyrophosphatase (Inorganic) 1 (PPA1)

Autre désignation: PPA1 (PPA1 Produits)

Synonymes: anticorps ppa, anticorps SCE9.16, anticorps PSPTO0722, anticorps AO090005001437, anticorps IOPPP, anticorps PP, anticorps PP1, anticorps SID6-8061, anticorps 2010317E03Rik, anticorps Pyp, anticorps Pp, anticorps inorganic pyrophosphatase, anticorps Inorganic pyrophosphatase, anticorps pyrophosphatase (inorganic) 1 L homeolog, anticorps pyrophosphatase (inorganic) 1, anticorps ppa, anticorps SCO3409, anticorps ppa-1, anticorps APE_1692.1, anticorps AOR_1_2492174, anticorps Celal_2154, anticorps Celly_1958, anticorps Dester_1338, anticorps Marky_0054, anticorps Halhy_5834, anticorps ppa1.L, anticorps PPA1, anticorps Ppa1

Classe de substances: Viral Protein

Sujet: PPA1 is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.

Poids moléculaire: 33 kDa (MW of target protein)