RBCK1 anticorps (Middle Region)

N° du produit ABIN629734

Détail du produit anti-RBCK1 anticorps

Antigène: RBCK1 (RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBCK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C20 ORF18 antibody was raised against the middle region of C20 rf18

Purification: Purified

Immunogène: C20 ORF18 antibody was raised using the middle region of C20 rf18 corresponding to a region with amino acids AYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C20ORF18 Blocking Peptide, catalog no. 33R-1633, is also available for use as a blocking control in assays to test for specificity of this C20ORF18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBCK1

Antigène: RBCK1 (RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1))

Autre désignation: C20ORF18 (RBCK1 Produits)

Synonymes: anticorps RBCK1, anticorps C20orf18, anticorps HOIL-1, anticorps HOIL1, anticorps RBCK2, anticorps RNF54, anticorps UBCE7IP3, anticorps XAP3, anticorps XAP4, anticorps ZRANB4, anticorps C20ORF18, anticorps AL033326, anticorps HOIL-1L, anticorps UIP28, anticorps Ubce7ip3, anticorps Pkcbpb15, anticorps zgc:91964, anticorps SHANK-associated RH domain interactor, anticorps RANBP2-type and C3HC4-type zinc finger containing 1, anticorps ranBP-type and C3HC4-type zinc finger-containing protein 1, anticorps RanBP-type and C3HC4-type zinc finger containing 1, anticorps SHARPIN, anticorps RBCK1, anticorps LOC100411512, anticorps Rbck1, anticorps rbck1

Sujet: C20orf18 is similar to mouse UIP28/UbcM4 interacting protein.

Poids moléculaire: 51 kDa (MW of target protein)