TNNI2 anticorps

N° du produit ABIN629866

Détail du produit anti-TNNI2 anticorps

Antigène: TNNI2 (Fast Skeletal Troponin I (TNNI2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNNI2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: Troponin I Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Troponin I Type 2 Blocking Peptide, catalog no. 33R-7190, is also available for use as a blocking control in assays to test for specificity of this Troponin I Type 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNNI2

Antigène: TNNI2 (Fast Skeletal Troponin I (TNNI2))

Abstract: TNNI2 Produits

Synonymes: anticorps AMCD2B, anticorps DA2B, anticorps FSSV, anticorps fsTnI, anticorps TnI-F4, anticorps TnI, anticorps TNI, anticorps hm:zehn0173, anticorps tnni2, anticorps tropI-1d, anticorps zgc:86800, anticorps troponin I2, fast skeletal type, anticorps troponin I type 2 (skeletal, fast), anticorps troponin I, fast skeletal muscle-like, anticorps troponin I, skeletal, fast 2, anticorps troponin I type 2a (skeletal, fast), tandem duplicate 4, anticorps TNNI2, anticorps Tnni2, anticorps tnni2a.4

Sujet: Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.

Poids moléculaire: 21 kDa (MW of target protein)