BRK1 anticorps (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit) (Middle Region)

Details for Product anti-BRK1 Antibody No. ABIN629872
  • brk1
  • C22H3orf10
  • brick1
  • c3orf10
  • C3orf10
  • MDS027
  • hHBrk1
  • 6720456B07Rik
  • AW011779
  • ATBRK1
  • BRICK1
  • HSPC300
  • T9I22.8
  • T9I22_8
  • BRICK1, SCAR/WAVE actin-nucleating complex subunit
  • BRICK1, SCAR/WAVE actin nucleating complex subunit
  • brick 1
  • BRICK1, SCAR/WAVE actin-nucleating complex subunit S homeolog
  • BRICK1
  • brk1
  • BRK1
  • Brk1
  • brk1.S
Middle Region
Humain, Souris, Rat (Rattus), Chien, Poisson zèbre (Danio rerio)
Cet anticorp BRK1 est non-conjugé
Immunohistochemistry (IHC), Western Blotting (WB)
Immunogène C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
Specificité C3 ORF10 antibody was raised against the middle region of C3 rf10
Purification Purified
Plasmids, Primers & others Plasmids, Primers & others BRK1 products on genomics-online (e.g. as negative or positive controls)
Autre désignation C3ORF10 (BRK1 Antibody Extrait)
Sujet C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
Poids moléculaire 9 kDa (MW of target protein)
Pathways Signalisation RTK
Indications d'application WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

C3ORF10 Blocking Peptide, catalog no. 33R-10134, is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images (Fournisseur)
Image no. 1 for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to...
Image no. 2 for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. M...
Image no. 3 for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody used at 2.5 ug/ml to detect target protein.
Avez-vous cherché autre chose?