BRK1 anticorps (Middle Region)
-
- Antigène Voir toutes BRK1 Anticorps
- BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BRK1 est non-conjugé
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificité
- C3 ORF10 antibody was raised against the middle region of C3 rf10
- Purification
- Purified
- Immunogène
- C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
- Top Product
- Discover our top product BRK1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C3ORF10 Blocking Peptide, catalog no. 33R-10134, is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))
- Autre désignation
- C3ORF10 (BRK1 Produits)
- Synonymes
- anticorps brk1, anticorps C22H3orf10, anticorps brick1, anticorps c3orf10, anticorps C3orf10, anticorps MDS027, anticorps hHBrk1, anticorps 6720456B07Rik, anticorps AW011779, anticorps ATBRK1, anticorps BRICK1, anticorps HSPC300, anticorps T9I22.8, anticorps T9I22_8, anticorps BRICK1, SCAR/WAVE actin-nucleating complex subunit, anticorps BRICK1, SCAR/WAVE actin nucleating complex subunit, anticorps brick 1, anticorps BRICK1, SCAR/WAVE actin-nucleating complex subunit S homeolog, anticorps BRICK1, anticorps brk1, anticorps BRK1, anticorps Brk1, anticorps brk1.S
- Sujet
- C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
- Poids moléculaire
- 9 kDa (MW of target protein)
- Pathways
- Signalisation RTK
-