SYNCRIP anticorps (N-Term)

N° du produit ABIN629882

Détail du produit anti-SYNCRIP anticorps

Antigène: SYNCRIP (Synaptotagmin Binding, Cytoplasmic RNA Interacting Protein (SYNCRIP))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SYNCRIP est non-conjugé

Application: Western Blotting (WB)

Specificité: SYNCRIP antibody was raised against the N terminal of SYNCRIP

Purification: Purified

Immunogène: SYNCRIP antibody was raised using the N terminal of SYNCRIP corresponding to a region with amino acids MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SYNCRIP Blocking Peptide, catalog no. 33R-5770, is also available for use as a blocking control in assays to test for specificity of this SYNCRIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNCRIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SYNCRIP

Antigène: SYNCRIP (Synaptotagmin Binding, Cytoplasmic RNA Interacting Protein (SYNCRIP))

Autre désignation: SYNCRIP (SYNCRIP Produits)

Synonymes: anticorps GRY-RBP, anticorps GRYRBP, anticorps HNRNPQ, anticorps HNRPQ1, anticorps NSAP1, anticorps PP68, anticorps hnRNP-Q, anticorps 2610109K23Rik, anticorps 4632417O19Rik, anticorps Nsap1, anticorps Nsap1l, anticorps pp68, anticorps nsap1, anticorps wu:fe02c03, anticorps wu:fe47h09, anticorps SYNCRIP, anticorps hnrpq1, anticorps gry-rbp, anticorps rp1-3j17.2, anticorps synaptotagmin binding cytoplasmic RNA interacting protein, anticorps synaptotagmin binding, cytoplasmic RNA interacting protein, anticorps synaptotagmin binding cytoplasmic RNA interacting protein S homeolog, anticorps SYNCRIP, anticorps Syncrip, anticorps syncrip, anticorps syncrip.S

Sujet: Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.

Poids moléculaire: 69 kDa (MW of target protein)