KCNN2 anticorps (C-Term)
-
- Antigène Voir toutes KCNN2 Anticorps
- KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNN2 antibody was raised against the C terminal of KCNN2
- Purification
- Purified
- Immunogène
- KCNN2 antibody was raised using the C terminal of KCNN2 corresponding to a region with amino acids IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
- Top Product
- Discover our top product KCNN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNN2 Blocking Peptide, catalog no. 33R-3914, is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))
- Autre désignation
- KCNN2 (KCNN2 Produits)
- Synonymes
- anticorps KCNN2, anticorps SK2, anticorps KCa2.2, anticorps SKCA2, anticorps SKCa 2, anticorps hSK2, anticorps fri, anticorps potassium calcium-activated channel subfamily N member 2, anticorps potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2, anticorps KCNN2, anticorps Kcnn2
- Sujet
- Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.
- Poids moléculaire
- 64 kDa (MW of target protein)
-